HPA004106

AP1G2 antibody from Atlas Antibodies
G2AD
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004106
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004106, RRID:AB_1078172
Product name
Anti-AP1G2
Provider product page
Atlas Antibodies - HPA004106
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PLVERDGPQADEEAKESKEAAQLSEAAPVPTEPQA
SQLLDLLDLLDGASGDVQHPPHLDPSPGGALVHLL
DLPCVPPPPAPIPDLKVFEREGVQLNLSFIRPPEN
PALLLITITATNFSEGDV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -