HPA004106

AP1G2 antibody from Sigma-Aldrich
G2AD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004106
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004106, RRID:AB_1078172
Product name
Anti-AP1G2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004106
Antibody type
Polyclonal
Antigen
Junctophilin-4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PLVERDGPQADEEAKESKEAAQLSEAAPVPTEPQA
SQLLDLLDLLDGASGDVQHPPHLDPSPGGALVHLL
DLPCVPPPPAPIPDLKVFEREGVQLNLSFIRPPEN
PALLLITITATNFSEGDV
Storage
-20C
Provider Type Product Number
- No reagents -