HPA001927

PREX1 antibody from Sigma-Aldrich
KIAA1415, P-REX1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001927
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001927, RRID:AB_1079674
Product name
Anti-PREX1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001927
Antibody type
Polyclonal
Antigen
Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CAGQCILKVNGSNVMNDGAPEVLEHFQAFRSRREE
ALGLYQWIYHTHEDAQEARASQEASTEDPSGEQAQ
EEDQADSAFPLLSLGPRLSLCEDSPMVTLTVDNVH
LEHGVVYEYVSTAGVRCHVLEKIVEP
Storage
-20C
Provider Type Product Number
- No reagents -