Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406249 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Leucine Zipper-EF-Hand Containing Transmembrane Protein 2 (LETM2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LETM2 antibody: synthetic peptide directed towards the N terminal of human LETM2
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
KNYESKKYSDPSQPGNTVLHPGTRLIQKLHTSTCW
LQEVP GKPQLEQATK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Inhibitor-sensitive FGFR1 amplification in human non-small cell lung cancer.
WHSC1L1, on human chromosome 8p11.2, closely resembles WHSC1 and maps to a duplicated region shared with 4p16.3.
Dutt A, Ramos AH, Hammerman PS, Mermel C, Cho J, Sharifnia T, Chande A, Tanaka KE, Stransky N, Greulich H, Gray NS, Meyerson M
PloS one 2011;6(6):e20351
PloS one 2011;6(6):e20351
WHSC1L1, on human chromosome 8p11.2, closely resembles WHSC1 and maps to a duplicated region shared with 4p16.3.
Stec I, van Ommen GJ, den Dunnen JT
Genomics 2001 Aug;76(1-3):5-8
Genomics 2001 Aug;76(1-3):5-8
No comments: Submit comment
No validations: Submit validation data