HPA025032

LETM2 antibody from Sigma-Aldrich
FLJ25409
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025032
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025032, RRID:AB_1852808
Product name
Anti-LETM2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025032
Antibody type
Polyclonal
Antigen
LETM1 domain-containing protein LETM2, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GLTEEQLRQQLTEWQDLHLKENVPPSLLLLSRTFY
LIDVKPKPIEIPLSGEAPKTDILVELPTFTE
Storage
-20C
Provider Type Product Number
- No reagents -