H00055959-M01

SULF2 antibody from Abnova Corporation
HSULF-2, KIAA1247, SULF-2

Antibody data

Product number
H00055959-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055959-M01, RRID:AB_1237889
Product name
SULF2 monoclonal antibody (M01), clone 2H5
Provider product page
Abnova Corporation - H00055959-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SULF2.
Antigen sequence
MPGLTCFTHDNQHWQTAPFWTLGPFCACTSANNNT
YWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQL
MNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRT
RNMDLGLKDGGSYEQYRQFQRRKWPEMKRPSSKSL
GQLWEGWEG
Isotype
IgG
Antibody clone number
2H5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -