HPA002325

SULF2 antibody from Sigma-Aldrich
HSULF-2, KIAA1247, SULF-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002325
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002325, RRID:AB_1080126
Product name
Anti-SULF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002325
Antibody type
Polyclonal
Antigen
Extracellular sulfatase Sulf-2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AWKDHKLHIDHEIETLQNKIKNLREVRGHLKKKRP
EECDCHKISYHTQHKGRLKHRGSSLHPFRKGLQEK
DKVWLLREQKRKKKLRKLLKRLQNNDTCSMPGLTC
FTHDNQHWQTAPFWTLGPFCACTSANNNTYWCMR
Storage
-20C
Provider Type Product Number
- No reagents -