HPA018430

PAPPA2 antibody from Sigma-Aldrich
PAPP-A2, PAPPE, PLAC3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018430
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018430, RRID:AB_1854961
Product name
Anti-PAPPA2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018430
Antibody type
Polyclonal
Antigen
Pappalysin-2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GDSSEDGHYFRGHLGTLVFWSTALPQSHFQHSSQH
SSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLE
VLQGFE
Storage
-20C
Provider Type Product Number
- No reagents -