HPA018412

antibody from Atlas Antibodies

Targeting: PAPPA2 PAPP-A2, PAPPE, PLAC3

Antibody data

Submit

Validation data

Product number: HPA018412 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA018412, RRID:AB_1854962
Product name: Anti-PAPPA2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: NPAGLRGAVEEPAAPWVGDSPIGQSELLGDDDAYL GNQRSKESLGEAGIQKGSAMAATTTTAIFTTLNEP KPETQRRGWAKSRQRRQVWKRRAEDGQGDSGISSH FQPWPKH
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PAPPA2 protein structure - HPA018412 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human placenta and prostate tissues using Anti-PAPPA2 antibody. Corresponding PAPPA2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human liver, lymph node, placenta and prostate using Anti-PAPPA2 antibody HPA018412 (A) shows similar protein distribution across tissues to independent antibody HPA018430 (B).
Antibody #2 product nr: HPA018430
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-PAPPA2 antibody HPA018412.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-PAPPA2 antibody HPA018412.
Sample type: HUMAN