Antibody data
- Antibody Data
 - Antigen structure
 - References [1]
 - Comments [0]
 - Validations
 - Western blot [2]
 - ELISA [1]
 - Immunohistochemistry [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - H00001108-M01 - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#H00001108-M01, RRID:AB_489933
 - Product name
 - CHD4 monoclonal antibody (M01), clone 4H4
 - Antibody type
 - Monoclonal
 - Description
 - Mouse monoclonal antibody raised against a partial recombinant CHD4.
 - Antigen sequence
 ETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEE
EEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIA
DGGFTELHSLWQNEERAATVTKKTYEIWH- Isotype
 - IgG
 - Antibody clone number
 - 4H4
 - Storage
 - Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
 
Submitted references		Physical and functional interactions between the histone H3K4 demethylase KDM5A and the nucleosome remodeling and deacetylase (NuRD) complex.
				
		
	
			Nishibuchi G, Shibata Y, Hayakawa T, Hayakawa N, Ohtani Y, Sinmyozu K, Tagami H, Nakayama J
The Journal of biological chemistry 2014 Oct 17;289(42):28956-70
		The Journal of biological chemistry 2014 Oct 17;289(42):28956-70
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - CHD4 monoclonal antibody (M01), clone 4H4 Western Blot analysis of CHD4 expression in Hela S3 NE ( Cat # L013V3 ).
 
- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Western Blot analysis of CHD4 expression in transfected 293T cell line by CHD4 monoclonal antibody (M01), clone 4H4.Lane 1: CHD4 transfected lysate(220 KDa).Lane 2: Non-transfected lysate.
 
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Detection limit for recombinant GST tagged CHD4 is approximately 0.03ng/ml as a capture antibody.
 - Validation comment
 - Sandwich ELISA (Recombinant protein)
 - Protocol
 - Protocol
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunoperoxidase of monoclonal antibody to CHD4 on formalin-fixed paraffin-embedded human transitional cell carcinoma. [antibody concentration 3 ug/ml]
 - Validation comment
 - Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
 - Protocol
 - Protocol