Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001108-M01A - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001108-M01A, RRID:AB_1573951
- Product name
- CHD4 monoclonal antibody (M01A), clone 4H4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CHD4.
- Antigen sequence
ETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEE
EEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIA
DGGFTELHSLWQNEERAATVTKKTYEIWH- Isotype
- IgG
- Antibody clone number
- 4H4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CHD4 monoclonal antibody (M01A), clone 4H4 Western Blot analysis of CHD4 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CHD4 expression in transfected 293T cell line by CHD4 monoclonal antibody (M01A), clone 4H4.Lane 1: CHD4 transfected lysate(220 KDa).Lane 2: Non-transfected lysate.