H00001108-M01A

CHD4 antibody from Abnova Corporation
Mi-2b, Mi2-BETA

Antibody data

Product number
H00001108-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001108-M01A, RRID:AB_1573951
Product name
CHD4 monoclonal antibody (M01A), clone 4H4
Provider product page
Abnova Corporation - H00001108-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CHD4.
Antigen sequence
ETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEE
EEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIA
DGGFTELHSLWQNEERAATVTKKTYEIWH
Isotype
IgG
Antibody clone number
4H4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -