Antibody data

Product number
H00010468-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010468-M01A, RRID:AB_1136935
Product name
FST monoclonal antibody (M01A), clone 1G4
Provider product page
Abnova Corporation - H00010468-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant FST.
Antigen sequence
MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLR
QAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDV
NDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKK
CRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYR
NECALLKARCKEQPELEVQYQGRCKKTCRDVFCPG
SSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGND
GVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSC
EDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSD
EPVCASDNATYASECAMKEAACSSGVLLEVKHSGS
CNSISEDTEEEEEDEDQDYSFPISSILEW
Isotype
IgM
Antibody clone number
1G4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -