Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA018155 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA018155, RRID:AB_1848999
- Product name
- Anti-FST
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSW
TEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDC
GPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLD
GKTYRNECA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Integrated single-cell and spatial transcriptomics reveal microenvironment disruptions by androgen in mouse ovary
Proteomics Characterization of Primary Human Oral Epithelial Cells Using a Novel Culture Technique for Use in Tissue Regeneration
Luo M, Yang X, Zhou M, Zhang J, Yu B, Lian H, Ye J
iScience 2024;27(10):111028
iScience 2024;27(10):111028
Proteomics Characterization of Primary Human Oral Epithelial Cells Using a Novel Culture Technique for Use in Tissue Regeneration
Feinberg S
MOJ Proteomics & Bioinformatics 2015;2(4)
MOJ Proteomics & Bioinformatics 2015;2(4)
No comments: Submit comment
No validations: Submit validation data