HPA021016

PLA2G3 antibody from Sigma-Aldrich
GIII-SPLA2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021016
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021016, RRID:AB_1855443
Product name
Anti-PLA2G3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021016
Antibody type
Polyclonal
Antigen
Group 3 secretory phospholipase A2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPPEVTNMLWELLGTTCFKLAPPLDCVEGKNCSRD
PRAIRVSARHLRRLQQRRHQLQDKGTDERQPWPSE
PLRGPMSFYNQCLQLTQAARRPDRQQKSWSQ
Storage
-20C
Provider Type Product Number
- No reagents -