H00051343-M02

FZR1 antibody from Abnova Corporation
CDC20C, CDH1, FZR, FZR2, HCDH, HCDH1, KIAA1242

Antibody data

Product number
H00051343-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051343-M02, RRID:AB_1136937
Product name
FZR1 monoclonal antibody (M02), clone 4C4
Provider product page
Abnova Corporation - H00051343-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant FZR1.
Antigen sequence
MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPAS
SPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKS
PSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIE
KVQDPQTEDRRLQPSTPEKKGLFTYSLSTKRSSPD
DGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIP
FKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVY
LWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVA
VGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWN
AEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQE
VCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQ
YTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFW
NTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGY
SQYQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDG
EAIVTGAGDETLRFWNVFSKTRSTKESVSVLNLVT
RIR
Isotype
IgG
Antibody clone number
4C4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -