H00051343-M09

FZR1 antibody from Abnova Corporation
CDC20C, CDH1, FZR, FZR2, HCDH, HCDH1, KIAA1242

Antibody data

Product number
H00051343-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051343-M09, RRID:AB_1204379
Product name
FZR1 monoclonal antibody (M09), clone 3E12
Provider product page
Abnova Corporation - H00051343-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant FZR1.
Antigen sequence
MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPAS
SPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKS
PSQNRKAKDATSDNGKDGLAYSALLKNELLG
Isotype
IgG
Antibody clone number
3E12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -