HPA005999

ABHD2 antibody from Sigma-Aldrich
LABH2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005999
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005999, RRID:AB_1078080
Product name
Anti-ABHD2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005999
Antibody type
Polyclonal
Antigen
Abhydrolase domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLF
EPLAEHCVGDDITMVICPGIANHSEKQYIRTFVDY
AQKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWE
FGAMVNYIKKTYPLTQLVVVGFSLGGNIVCKYLGE
TQANQEKVL
Storage
-20C
Provider Type Product Number
- No reagents -