Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00065018-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00065018-A01, RRID:AB_529881
- Product name
- PINK1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant PINK1.
- Antigen sequence
FRLEEYLIGQSIGKGCSAAVYEATMPTLPQNLEVT
KSTGLLPGRGPGTSAPGEGQERAAGAPAFPLAIKM
MWNISAGSSSEAILNTMSQELVPASRVALA- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Comparative gene identification-58 (CGI-58) promotes autophagy as a putative lysophosphatidylglycerol acyltransferase.
Ablation of ALCAT1 mitigates hypertrophic cardiomyopathy through effects on oxidative stress and mitophagy.
Zhang J, Xu D, Nie J, Han R, Zhai Y, Shi Y
The Journal of biological chemistry 2014 Nov 21;289(47):33044-53
The Journal of biological chemistry 2014 Nov 21;289(47):33044-53
Ablation of ALCAT1 mitigates hypertrophic cardiomyopathy through effects on oxidative stress and mitophagy.
Liu X, Ye B, Miller S, Yuan H, Zhang H, Tian L, Nie J, Imae R, Arai H, Li Y, Cheng Z, Shi Y
Molecular and cellular biology 2012 Nov;32(21):4493-504
Molecular and cellular biology 2012 Nov;32(21):4493-504
No comments: Submit comment
No validations: Submit validation data