HPA001931

PINK1 antibody from Sigma-Aldrich
PARK6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001931
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001931, RRID:AB_1079620
Product name
Anti-PINK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001931
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase PINK1, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GVDHLVQQGIAHRDLKSDNILVELDPDGCPWLVIA
DFGCCLADESIGLQLPFSSWYVDRGGNGCLMAPEV
STARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPF
YGQGKAHLESRSYQEAQLP
Storage
-20C
Provider Type Product Number
- No reagents -