ABIN503568

GZMA antibody from antibodies-online
CTLA3, HFSP
Western blot
Recommended by provider

Antibody data

Product number
ABIN503568
Provider
antibodies-online
Product name
anti-Granzyme A (Granzyme 1, Cytotoxic T-Lymphocyte-Associated serine Esterase 3) (GZMA) antibody
Provider product page
antibodies-online - ABIN503568
Antibody type
Polyclonal
Antigen
The immunogen for anti-GZMA antibody: synthetic peptide directed towards the middle region of human GZMA
Reactivity
Human, Mouse, Rat, Bovine, Porcine
Host
Rabbit
Antigen sequence
TREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKP
GTMCQ VAGWGRTHNS
Vial size
50 µg
Provider Type Product Number
- No reagents -