HPA020547

UBQLN3 antibody from Atlas Antibodies
TUP-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020547
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020547, RRID:AB_1858577
Product name
Anti-UBQLN3
Provider product page
Atlas Antibodies - HPA020547
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ATEAPRLLLWFMPCLAGTGSVAGGIESREDPLMSE
DPLPNPPPEVFPALDSAELGFLSPPFLHMLQDLVS
TNPQQLQPEAHFQVQLEQL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -