HPA020547

UBQLN3 antibody from Sigma-Aldrich
TUP-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020547
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020547, RRID:AB_1858577
Product name
Anti-UBQLN3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020547
Antibody type
Polyclonal
Antigen
Ubiquilin-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATEAPRLLLWFMPCLAGTGSVAGGIESREDPLMSE
DPLPNPPPEVFPALDSAELGFLSPPFLHMLQDLVS
TNPQQLQPEAHFQVQLEQL
Storage
-20C
Provider Type Product Number
- No reagents -