HPA002552

FMNL3 antibody from Sigma-Aldrich
DKFZp762B245, MGC45819, WBP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002552
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002552, RRID:AB_1078862
Product name
Anti-FMNL3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002552
Antibody type
Polyclonal
Antigen
Formin-like 3 isoform 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLDVKELGRGMELIRRECSIHDNSVLRNFLSTNEG
KLDKLQRDAKTAEEAYNAVVRYFGESPKTTPPSVF
FPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQ
EAKKLDAKTPSQRNKWQQQE
Storage
-20C
Provider Type Product Number
- No reagents -