H00010678-M05
antibody from Abnova Corporation
		Targeting: B3GNT2
		
		B3GN-T1, B3GN-T2, B3GNT-2, B3GNT1, BETA3GNT	
	
	
	
	
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010678-M05 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010678-M05, RRID:AB_605972
- Product name
- B3GNT2 monoclonal antibody (M05), clone 1A8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant B3GNT2.
- Antigen sequence
- NLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLL
 LAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVF
 LLGQTPPEDNHPDLSDMLKFESEKHQDILM
- Isotype
- IgG
- Antibody clone number
- 1A8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Western Blot analysis of B3GNT2 expression in transfected 293T cell line by B3GNT2 monoclonal antibody (M05), clone 1A8.Lane 1: B3GNT2 transfected lysate(46.022 KDa).Lane 2: Non-transfected lysate.
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Detection limit for recombinant GST tagged B3GNT2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol