HPA005997

B3GNT2 antibody from Sigma-Aldrich
B3GN-T1, B3GN-T2, B3GNT-2, B3GNT1, BETA3GNT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005997
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005997, RRID:AB_1845234
Product name
Anti-B3GNT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005997
Antibody type
Polyclonal
Antigen
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLF
IGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGG
GGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQ
KLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVH
SRKPQEMI
Storage
-20C
Provider Type Product Number
- No reagents -