HPA003919

CHST7 antibody from Sigma-Aldrich
C6ST-2, C6ST2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003919
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003919, RRID:AB_10601258
Product name
Anti-CHST7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003919
Antibody type
Polyclonal
Antigen
carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PMWHLWQALYPGDAESLQGALRDMLRSLFRCDFSV
LRLYAPPGDPAARAPDTANLTTAALFRWRTNKVIC
SPPLCPGAPRARAEVGLVEDTACERSCPPVAIRAL
EAECRKYPVVVIKDVRLLDLGVLVPLLRDPGLNLK
VVQL
Storage
-20C
Provider Type Product Number
- No reagents -