HPA002951

CSPG4 antibody from Atlas Antibodies
HMW-MAA, MCSP, MCSPG, MEL-CSPG, MSK16, NG2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002951
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002951, RRID:AB_1854449
Product name
Anti-CSPG4
Provider product page
Atlas Antibodies - HPA002951
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ILYEHEMPPEPFWEAHDTLELQLSSPPARDVAATL
AVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITV
AALDASNLLASVPSPQRSEHDVLFQVTQFPSRGQL
LVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQ
DGFHFRAHL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -