HPA002951

CSPG4 antibody from Sigma-Aldrich
HMW-MAA, MCSP, MCSPG, MEL-CSPG, MSK16, NG2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002951
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002951, RRID:AB_1854449
Product name
Anti-CSPG4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002951
Antibody type
Polyclonal
Antigen
Chondroitin sulfate proteoglycan 4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ILYEHEMPPEPFWEAHDTLELQLSSPPARDVAATL
AVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITV
AALDASNLLASVPSPQRSEHDVLFQVTQFPSRGQL
LVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQ
DGFHFRAHL
Storage
-20C
Provider Type Product Number
- No reagents -