HPA038318

DHX29 antibody from Atlas Antibodies
DDX29
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA038318
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA038318, RRID:AB_10672589
Product name
Anti-DHX29
Provider product page
Atlas Antibodies - HPA038318
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EEEEEVTINVTSKAGGIKKYQEYIPVQTGAHADLN
PFYQKYSSRTQHAILYMNPHKINLDLILELLAYLD
KSPQFRNIEGAV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -