SAB1400582

DHX29 antibody from Sigma-Aldrich
DDX29
ELISA
Recommended by provider

Antibody data

Product number
SAB1400582
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400582, RRID:AB_1847663
Product name
Anti-DHX29 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400582
Antibody type
Polyclonal
Antigen
DHX29 (NP_061903, a.a. 1-1369) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MGGKNKKHKAPAAAVVRAAVSASRAKSAEAGIAGE
AQSKKPVSRPATAAAAAAGSREPRVKQGPKIYSFN
STNDSSGPANLDKSILKVVINNKLEQRIIGVINEH
KKQNNDKGMISGRLTAKKLQDLYMALQAFSFKTKD
IEDAMTNTLLYGGDLHSALDWLCLNLSDDALPEGF
SQEFEEQQPKSRPKFQSPQIQATISPPLQPKTKTY
EEDPKSKPKKEEKNMEVNMKEWILRYAEQQNEEEK
NENSKSLEEEEKFDPNERYLHLAAKLLDAKEQAAT
FKLEKNKQGQKEAQEKIRKFQREMETLEDHPVFNP
AMKISHQQNERKKPPVATEGESALNFNLFEKSAAA
TEEEKDKKKEPHDVRNFDYTARSWTGKSPKQFLID
WVRKNLPKSPNPSFEKVPVGRYWKCRVRVIKSEDD
VLVVCPTILTEDGMQAQHLGATLALYRLVKGQSVH
Storage
-20C
Provider Type Product Number
- No reagents -