PAB28602

FRMD8 antibody from Abnova Corporation
FKSG44, FLJ90369, iTAP

Antibody data

Product number
PAB28602
Provider
Abnova Corporation
Product name
FRMD8 polyclonal antibody
Provider product page
Abnova Corporation - PAB28602
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant FRMD8.
Antigen sequence
SREKHVLLGLRFQELSWDHTSPEEEEPILWLEFDG
DSEGTPVNKLLKIYSKQAELMSSLIEYCIELSQAA
EPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVV
SSRIQHLSTIDYVED
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.