H00083786-B01

FRMD8 antibody from Abnova Corporation
FKSG44, FLJ90369, iTAP

Antibody data

Product number
H00083786-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00083786-B01, RRID:AB_1113719
Product name
FKSG44 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00083786-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human FKSG44 protein.
Antigen sequence
MDGTEGSAGQPGPAERSHRSSVSSVGARAADVLVY
LADDTVVPLAVENLPSLSAHELHRAVREVLQLPDI
ALDVFALWLVSPLLEVQLKPKHQPYKLGRQWPELL
LRFTSAPDDDVAMDEPFLQFRRNVFFPKRRELQIH
DEEVLRLLYEEAKGNVLAARYPCDVEDCEALGALV
CRVQLGPYQPGRPAACDLREKLDSFLPAHLCKRGQ
SLFAALRGRGARAGPGEQGLLNAYRQVQEVSSDGG
CEAALGTHYRAYLLKCHELPFYGCAFFHGEVDKPA
QGFLHRGGRKPVSVAISLEGVHVIDSREKHVLLGL
RFQELSWDHTSPEEEEPILWLEFDGDSEGTPVNKL
LKIYSKQAELMSSLIEYCIELSQAAEPAGPQDSAT
GSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTI
DYVEDGKGIRRVKPKRTTSFFSRQLSLGQGSYTVV
QPGDSLEQG
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.