HPA026915

COPS7A antibody from Sigma-Aldrich
CSN7A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026915
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026915, RRID:AB_1847156
Product name
Anti-COPS7A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026915
Antibody type
Polyclonal
Antigen
COP9 signalosome complex subunit 7a recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGV
YVFGELLDMPNVRELAESDFASTFRLLTVFAYGTY
ADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKC
IPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSL
D
Storage
-20C
Provider Type Product Number
- No reagents -