Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182616 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Activator of Basal Transcription 1 (ABT1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ABT1 antibody: synthetic peptide directed towards the middle region of human ABT1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
EVAQAKRETDFYLQSVERGQRFLAADGDPARPDGS
WTFAQ RPTEQELRAR- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A novel TATA-binding protein-binding protein, ABT1, activates basal transcription and has a yeast homolog that is essential for growth.
Oda T, Kayukawa K, Hagiwara H, Yudate HT, Masuho Y, Murakami Y, Tamura TA, Muramatsu MA
Molecular and cellular biology 2000 Feb;20(4):1407-18
Molecular and cellular biology 2000 Feb;20(4):1407-18
No comments: Submit comment
No validations: Submit validation data