HPA025066

C8orf86 antibody from Sigma-Aldrich
FLJ43582
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA025066
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA025066, RRID:AB_1848937
Product name
Anti-C8orf86 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA025066
Antibody type
Polyclonal
Antigen
Putative uncharacterized protein FLJ43582 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLEPIKLFPVSSLRSPLCLNCGSCRESIRISGELI
GNAHSPAPPRTPELETLGWDKQAVLSGAQVILVCA
Storage
-20C
Provider Type Product Number
- No reagents -