Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1105222 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-AChE Q Subunit (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-COLQ antibody: synthetic peptide directed towards the N terminal of human COLQ.
- Description
- Purified using Protein A affinity column
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
LQLFFLSIVSQPTFINSVLPISAALPSLDQKKRGG
HKACCLLTPPPPPLF- Epitope
- N-Term
- Vial size
- 0.1 mg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Transcriptional regulation of acetylcholinesterase-associated collagen ColQ in fast- and slow-twitch muscle fibers.
Ting AK, Siow NL, Kong LW, Tsim KW
Chemico-biological interactions 2005 Dec 15;157-158:63-70
Chemico-biological interactions 2005 Dec 15;157-158:63-70
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human HepG2; WB Suggested Anti-COLQ Antibody. . Titration: 1.25 ug/ml. . Positive Control: HepG2 Whole Cell; COLQ antibody - N-terminal region (AP42286PU-N) in Human HepG2 cells using Western Blot