Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311015 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Aldolase C, Fructose-Bisphosphate (ALDOC) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ALDOC antibody: synthetic peptide directed towards the N terminal of human ALDOC
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MPHSYPALSAEQKKELSDIALRIVAPGKGILAADE
SVGSM AKRLSQIGVE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
Kim SC, Sprung R, Chen Y, Xu Y, Ball H, Pei J, Cheng T, Kho Y, Xiao H, Xiao L, Grishin NV, White M, Yang XJ, Zhao Y
Molecular cell 2006 Aug;23(4):607-18
Molecular cell 2006 Aug;23(4):607-18
No comments: Submit comment
No validations: Submit validation data