HPA003282

ALDOC antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003282
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003282, RRID:AB_1078130
Product name
Anti-ALDOC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003282
Antibody type
Polyclonal
Antigen
Fructose-bisphosphate aldolase C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MPHSYPALSAEQKKELSDIALRIVAPGKGILAADE
SVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRV
KKCIGGVI
Storage
-20C
Provider Type Product Number
- No reagents -