Antibody data

Product number
H00002038-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002038-M01, RRID:AB_1204323
Product name
EPB42 monoclonal antibody (M01), clone 2G12
Provider product page
Abnova Corporation - H00002038-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant EPB42.
Antigen sequence
KMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILG
RGLIHRERSYRFRSVWPENTMCAKFQFTPTHVGLQ
RLTVEVDCNMFQNLTNYKSVTVVAPELSA
Isotype
IgG
Antibody clone number
2G12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -