Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003426 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003426, RRID:AB_1079735
- Product name
- Anti-RAB5C
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNA
TGAPGRNRGVDLQENNPASRSQCCSN- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Inhibition of cell proliferation and migration by miR-509-3p that targets CDK2, Rac1, and PIK3C2A.
Identification of components of the host type IA phosphoinositide 3-kinase pathway that promote internalization of Listeria monocytogenes.
Rab5 isoforms differentially regulate the trafficking and degradation of epidermal growth factor receptors.
Yoon S, Han E, Choi YC, Kee H, Jeong Y, Yoon J, Baek K
Molecules and cells 2014 Apr;37(4):314-21
Molecules and cells 2014 Apr;37(4):314-21
Identification of components of the host type IA phosphoinositide 3-kinase pathway that promote internalization of Listeria monocytogenes.
Jiwani S, Wang Y, Dowd GC, Gianfelice A, Pichestapong P, Gavicherla B, Vanbennekom N, Ireton K
Infection and immunity 2012 Mar;80(3):1252-66
Infection and immunity 2012 Mar;80(3):1252-66
Rab5 isoforms differentially regulate the trafficking and degradation of epidermal growth factor receptors.
Chen PI, Kong C, Su X, Stahl PD
The Journal of biological chemistry 2009 Oct 30;284(44):30328-38
The Journal of biological chemistry 2009 Oct 30;284(44):30328-38
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines A-549 and PC-3 using Anti-RAB5C antibody. Corresponding RAB5C RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
- Sample type
- HUMAN