HPA003426

RAB5C antibody from Sigma-Aldrich
RAB5CL, RABL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003426
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003426, RRID:AB_1079735
Product name
Anti-RAB5C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003426
Antibody type
Polyclonal
Antigen
Ras-related protein Rab-5C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNA
TGAPGRNRGVDLQENNPASRSQCCSN
Storage
-20C
Provider Type Product Number
- No reagents -