HPA020233

AMZ1 antibody from Sigma-Aldrich
KIAA1950
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020233
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020233, RRID:AB_1844818
Product name
Anti-AMZ1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020233
Antibody type
Polyclonal
Antigen
Archaemetzincin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AIKEHERWLAMCIQALQREVAEEDLVQVDRAVDAL
DRWEMFTGQLPATRQDPPSSRDSVGLRKVLGDKFS
SLRRKLSARKLARAESAPRPWDG
Storage
-20C
Provider Type Product Number
- No reagents -