HPA019804

UBAP1 antibody from Sigma-Aldrich
UBAP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019804
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019804, RRID:AB_1858494
Product name
Anti-UBAP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019804
Antibody type
Polyclonal
Antigen
Ubiquitin-associated protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FHGTFSYLDDVPFKTGDKFKTPAKVGLPIGFSLPD
CLQVVREVQYDFSLEKKTIEWAEEIKKIEEAEREA
ECKIAEAEAKVNSKSGPEGDSKMSFSKTHS
Storage
-20C
Provider Type Product Number
- No reagents -