H00008611-B01P

PLPP1 antibody from Abnova Corporation
LPP1, PAP-2a, PPAP2A

Antibody data

Product number
H00008611-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008611-B01P, RRID:AB_10735342
Product name
PPAP2A purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00008611-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PPAP2A protein.
Antigen sequence
MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQ
RGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIV
IILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTF
LFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSK
INCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFS
MYCMLFVALYLQARMKGDWARLLRPTLQFGLVAVS
IYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVY
VSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPS
NHQP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -