ABIN567161

PLPP1 antibody from antibodies-online
LPP1, PAP-2a, PPAP2A

Antibody data

Product number
ABIN567161
Provider
antibodies-online
Product name
anti-Phosphatidic Acid Phosphatase Type 2A (PPAP2A) (N-Term) antibody
Provider product page
antibodies-online - ABIN567161
Antibody type
Polyclonal
Antigen
The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A
Reactivity
Human
Host
Rabbit
Antigen sequence
QRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSII
VIILG ETLSVYCNLL
Vial size
50 µg
Provider Type Product Number
- No reagents -