ABIN310287

PLPP1 antibody from antibodies-online
LPP1, PAP-2a, PPAP2A

Antibody data

Product number
ABIN310287
Provider
antibodies-online
Product name
anti-Phosphatidic Acid Phosphatase Type 2A (PPAP2A) (Middle Region) antibody
Provider product page
antibodies-online - ABIN310287
Antibody type
Polyclonal
Antigen
The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A
Description
Protein A purified
Reactivity
Human, Mouse, Rat, Bovine, Chicken/Avian, Porcine, Rabbit, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYS
GHSSF SMYCMLFVAL
Epitope
Middle Region
Vial size
100 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -