ABIN310386

PLPP1 antibody from antibodies-online
LPP1, PAP-2a, PPAP2A

Antibody data

Product number
ABIN310386
Provider
antibodies-online
Product name
anti-Phosphatidic Acid Phosphatase Type 2A (PPAP2A) antibody
Provider product page
antibodies-online - ABIN310386
Antibody type
Polyclonal
Antigen
The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A
Reactivity
Human, Mouse, Rat, Xenopus
Host
Rabbit
Antigen sequence
QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGV
GLPIS SIILGETLSV
Vial size
0.1 mg
Provider Type Product Number
- No reagents -