Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310386 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Phosphatidic Acid Phosphatase Type 2A (PPAP2A) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A
- Reactivity
- Human, Mouse, Rat, Xenopus
- Host
- Rabbit
- Antigen sequence
QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGV
GLPIS SIILGETLSV- Vial size
- 0.1 mg
Submitted references Lysophosphatidic acid mediates myeloid differentiation within the human bone marrow microenvironment.
Role of decreased levels of lipid phosphate phosphatase-1 in accumulation of lysophosphatidic acid in ovarian cancer.
Evseenko D, Latour B, Richardson W, Corselli M, Sahaghian A, Cardinal S, Zhu Y, Chan R, Dunn B, Crooks GM
PloS one 2013;8(5):e63718
PloS one 2013;8(5):e63718
Role of decreased levels of lipid phosphate phosphatase-1 in accumulation of lysophosphatidic acid in ovarian cancer.
Tanyi JL, Hasegawa Y, Lapushin R, Morris AJ, Wolf JK, Berchuck A, Lu K, Smith DI, Kalli K, Hartmann LC, McCune K, Fishman D, Broaddus R, Cheng KW, Atkinson EN, Yamal JM, Bast RC, Felix EA, Newman RA, Mills GB
Clinical cancer research : an official journal of the American Association for Cancer Research 2003 Sep 1;9(10 Pt 1):3534-45
Clinical cancer research : an official journal of the American Association for Cancer Research 2003 Sep 1;9(10 Pt 1):3534-45
No comments: Submit comment
No validations: Submit validation data