AV42721

PLPP1 antibody from Sigma-Aldrich
LPP1, PAP-2a, PPAP2A
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV42721
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV42721, RRID:AB_1855607
Product name
Anti-PPAP2A (AB2) antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV42721
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human PPAP2A with an internal ID of P11105
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
QRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPIS
SIILGETLSVYCNLL
Storage
-20C
Provider Type Product Number
- No reagents -