HPA018858

GPA33 antibody from Sigma-Aldrich
A33
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018858
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018858, RRID:AB_1849909
Product name
Anti-GPA33 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018858
Antibody type
Polyclonal
Antigen
Cell surface A33 antigen precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGI
EGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQ
EQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEG
TQFCNITVA
Storage
-20C
Provider Type Product Number
- No reagents -