HPA003417

JAM3 antibody from Sigma-Aldrich
JAM-C, JAMC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003417
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003417, RRID:AB_1851981
Product name
Anti-JAM3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003417
Antibody type
Polyclonal
Antigen
Junctional adhesion molecule C precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTP
VCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRND
VPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKD
DSGQYYCIASNDAGSARCEEQEMEVYDLNIG
Storage
-20C
Provider Type Product Number
- No reagents -